WWW.CHOUDHARYSERVICES.IN

At Choudhary Services - we undertake Fire Protection System, Plumbing Works, Mechanical, Electrical and Plumbing, MEP Services, Fire and Life Safety, fire fighting.

Valuation Information

choudharyservices.in was registered 3 months 3 weeks ago. It has a alexa rank of #6,993,924 in the world. It is a domain having .in extension. It is estimated worth of $ 240.00 and have a daily income of around $ 1.00. choudharyservices.in is SUSPICIOUS and may contains potentially risky contents. You should be careful while visiting this website.

Stats & Details

Traffic Report

Daily Unique Visitors: 124
Monthly Unique Visitors: 2,976

Estimated Valuation

Income Per Day: $ 1.00
Estimated Worth: $ 240.00

Search Engine Indexes

Google Indexed Pages: N/A
Yahoo Indexed Pages: N/A
Bing Indexed Pages: N/A

Search Engine Backlinks

Google Backlinks: N/A
Bing Backlinks: N/A
Alexa BackLinks: N/A

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Minor Risk Issues

Website Ranks & Scores

Alexa Rank: 6,993,924
PageSpeed Score: N/A
Web Server Information
Hosted IP Address
161.97.135.95
Hosted Country
United States US
Location Latitude
39.9914
Location Longitude
-105.2392
Server Location
Colorado, Boulder, United States, 80303
Location on MAP
Page Title of choudharyservices.in
Fire Protection System, Plumbing Works - Choudhary Services
Website Inpage Analysis
H1 Headings: 0 H2 Headings: 4
H3 Headings: 16 H4 Headings: 0
H5 Headings: 3 H6 Headings: 0
Total IFRAMEs: 0 Total Images: 30
Google Adsense: N/A Google Analytics: UA-186342573-1
Websites Hosted on Same IP 161.97.135.95
hydhosting.com favicon hydhosting.com - HydHosting - Domain and Cheap Web Hosting Provider in India

Description: Domain and Cheap Web Hosting Provider in India for your business website or blog. We assure your a stable, affordable and secure web hosting environment at Hydhosting.

3,038,896   $ 480.00

icsp-hyderabad.com favicon icsp-hyderabad.com - Home - Institute of Clinical SAS Programming

Description: Institute of Clinical SAS Programming offers a Online Clinical SAS Training, Clinical SAS programming course for 6 months duration.

99,999,999   $ 8.95

zabeenfabrication.in favicon zabeenfabrication.in - Zabeen Fabrication - Fabricattion & Engineering Works In Hyderabad

Description: Zabeen Fabrication is well known for its quality Fabrication and Engineering works in and around Hyderabad Surroundings

99,999,999   $ 8.95

muslimquest.com favicon muslimquest.com - Muslim Quest » Search of Ilm...

Description: Muslim Quest is a Educational website on Islamic topics. Muslim Quest contain information on Iman, Ibadat, Sunnat, Shariah and conditions of present muslims

99,999,999   $ 8.95
HTTP Header Analysis
HTTP/1.1 200 OK
Date: Tue, 02 Mar 2021 15:58:41 GMT
Server: Apache
Vary: User-Agent,Accept-Encoding
Last-Modified: Sun, 14 Feb 2021 09:34:30 GMT
Accept-Ranges: bytes
Cache-Control: max-age=0, no-cache, no-store, must-revalidate
Expires: Mon, 29 Oct 1923 20:30:00 GMT
Content-Encoding: gzip
Pragma: no-cache
Content-Length: 20044
Content-Type: text/html; charset=UTF-8
Domain Information
Domain Registrar: INRegistry
Registration Date: 2020-12-18 3 months 3 weeks 4 days ago
Domain Nameserver Information
Host IP Address Country
ns1.hydhosting.com 161.97.135.95 United States United States
ns2.hydhosting.com 161.97.135.95 United States United States
DNS Record Analysis
Host Type TTL Extra
choudharyservices.in A 14400 IP: 161.97.135.95
choudharyservices.in NS 86400 Target: ns2.hydhosting.com
choudharyservices.in NS 86400 Target: ns1.hydhosting.com
choudharyservices.in SOA 86400 MNAME: ns1.hydhosting.com
RNAME: info.hydhosting.com
Serial: 2021021302
Refresh: 3600
Retry: 1800
Expire: 1209600
choudharyservices.in MX 14400 Target: choudharyservices.in
choudharyservices.in TXT 14400 TXT: v=spf1 +a +mx +ip4:161.97.135.95 ~all
Similarly Ranked Websites
newalpha.com favicon newalpha.com - La Française Group

Description: With four core activities - securities, real estate, investment solutions, and direct financing -La Française deploys its multi-affiliate business model with institutional and...

6,993,932   $ 240.00

aidanries.github.io favicon aidanries.github.io - Site not found · GitHub Pages
6,993,934   $ 240.00

thomassalzano.wordpress.com favicon thomassalzano.wordpress.com - Thomas Salzano | Thomas N Salzano | Thomas J Salzano | Thomas...

Description: Thomas Salzano aka Thomas N Salzano aka Thomas J Salzano is a professional writer having a decade experience. Thomas Salzano has created this blog for sharing his personal...

6,993,975   $ 240.00

vacando.ch favicon vacando.ch - VACANDO - Ferienhäuser & Ferienwohnungen günstig mieten

Description: Über 100'000 Ferienhäuser und Ferienwohnungen in 31 Ländern - alle online buchbar bei Vacando. Hier wohnen die Ferien.

6,993,978   $ 240.00

adanaevdenevenakliyatfirmalari.com favicon adanaevdenevenakliyatfirmalari.com - Adana Evden Eve Nakliyat ve Taşımacılık - 0322 270 00 70

Description: Adana evden eve nakliyat ve Adana evden eve taşımacılık firması olarak siz değerli müşterilerimize hizmet vermekten gurur duyarız. Sayısız referanslarımıza site üzerinden ulaşa...

6,993,990   $ 240.00

Alexa Traffic Rank

Alexa Traffic Rank

Alexa Search Engine Traffic

Alexa Search Engine Traffic
Full Whois Lookup
Domain Name: choudharyservices.in
Registry Domain ID:
D388F52E6DADD4ACA8F1FA8D24B58CA32-IN
Registrar WHOIS
Server:
Registrar URL:
https://publicdomainregistry.com/
Updated Date:
2020-12-23T07:27:46Z
Creation Date:
2020-12-18T07:27:45Z
Registry Expiry Date:
2021-12-18T07:27:45Z
Registrar: Endurance Domains Technology
LLP
Registrar IANA ID: 801217
Registrar Abuse Contact
Email:
Registrar Abuse Contact Phone:
Domain Status:
clientTransferProhibited
http://www.icann.org/epp#clientTransferProhibited
Registry
Registrant ID: REDACTED FOR PRIVACY
Registrant Name: REDACTED FOR
PRIVACY
Registrant Organization: Choudhary Services
Registrant
Street: REDACTED FOR PRIVACY
Registrant Street: REDACTED FOR
PRIVACY
Registrant Street: REDACTED FOR PRIVACY
Registrant
City: REDACTED FOR PRIVACY
Registrant State/Province:
Telangana
Registrant Postal Code: REDACTED FOR
PRIVACY
Registrant Country: IN
Registrant Phone: REDACTED FOR
PRIVACY
Registrant Phone Ext: REDACTED FOR PRIVACY
Registrant
Fax: REDACTED FOR PRIVACY
Registrant Fax Ext: REDACTED FOR
PRIVACY
Registrant Email: Please contact the Registrar listed
above
Registry Admin ID: REDACTED FOR PRIVACY
Admin Name:
REDACTED FOR PRIVACY
Admin Organization: REDACTED FOR
PRIVACY
Admin Street: REDACTED FOR PRIVACY
Admin Street:
REDACTED FOR PRIVACY
Admin Street: REDACTED FOR PRIVACY
Admin
City: REDACTED FOR PRIVACY
Admin State/Province: REDACTED FOR
PRIVACY
Admin Postal Code: REDACTED FOR PRIVACY
Admin Country:
REDACTED FOR PRIVACY
Admin Phone: REDACTED FOR PRIVACY
Admin
Phone Ext: REDACTED FOR PRIVACY
Admin Fax: REDACTED FOR
PRIVACY
Admin Fax Ext: REDACTED FOR PRIVACY
Admin Email:
Please contact the Registrar listed above
Registry Tech ID:
REDACTED FOR PRIVACY
Tech Name: REDACTED FOR PRIVACY
Tech
Organization: REDACTED FOR PRIVACY
Tech Street: REDACTED FOR
PRIVACY
Tech Street: REDACTED FOR PRIVACY
Tech Street:
REDACTED FOR PRIVACY
Tech City: REDACTED FOR PRIVACY
Tech
State/Province: REDACTED FOR PRIVACY
Tech Postal Code: REDACTED
FOR PRIVACY
Tech Country: REDACTED FOR PRIVACY
Tech Phone:
REDACTED FOR PRIVACY
Tech Phone Ext: REDACTED FOR PRIVACY
Tech
Fax: REDACTED FOR PRIVACY
Tech Fax Ext: REDACTED FOR
PRIVACY
Tech Email: Please contact the Registrar listed
above
Name Server: ns1.hydhosting.com
Name Server:
ns2.hydhosting.com
DNSSEC: unsigned
URL of the ICANN Whois
Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last
update of WHOIS database: 2021-03-02T15:58:49Z

Recently Analyzed Sites

Recently Viewed